PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.007G136900.1
Common NamePOPTR_0007s01230g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 435aa    MW: 47818 Da    PI: 6.8029
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.007G136900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.4e-28158212156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Potri.007G136900.1 158 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 212
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.152155214IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-26156215IPR009057Homeodomain-like
SuperFamilySSF466891.7E-18156215IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-26158212IPR006447Myb domain, plants
PfamPF002494.6E-8161210IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MLAVSPLRNT PATKDESQEQ MESYSTIFNG EFPDFSEGSL LESIDFDDLF VSIDDEDVLP  60
NLEMDPEILA EFSVSGSGGE ESDVNTSVSN AKVEDSIHRK DEEDKFSGLD SSLSTRGEEI  120
VSKRDESVVV NPVPNKDGEK GRKPAAHAKN NNNQGKRKVK VDWTPELHRR FVQAVEQLGV  180
DKAVPSRILE LMGIDCLTRH NIASHLQKYR SHRKHLLARE AEAANWSQRR QMYGAAAASG  240
GGKRDISAWH ALTMGFPPIT HPMHHHFRPL HVWGHPSMGQ SPMHMWPKHL AHSPSPSPPR  300
PLPPPPTWHP PPPPPPDPSY WHHHPHQRVP NGLTPGTPCF PQPLATRFPA PPVPGIPPHA  360
MYKVDPGIGL LTGQPGPSPL FDFHPSKESV DAVIGDVLSK PWLPLPLGLK APATDSVLVE  420
LQKQGVPKIP PTRA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15155210257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090020.0AC209002.1 Populus trichocarpa clone POP040-E22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310413.20.0hypothetical protein POPTR_0007s01230g
SwissprotQ9SIV31e-101GLK1_ARATH; Transcription activator GLK1
TrEMBLB9HGR10.0B9HGR1_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01230.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-81GBF's pro-rich region-interacting factor 1